PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00016.1.g06200.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family GRAS
Protein Properties Length: 252aa    MW: 28945 Da    PI: 6.4059
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00016.1.g06200.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS223.79e-696250131374
                          GRAS 131 aLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlq 209
                                    LasR++gpp+lRiTg++ pe+g    +++eetg+rLa++Ae ++v+f+++  +++++e++++e+++++++E+l++n+ ++
  Zjn_sc00016.1.g06200.1.am.mk   6 HLASREGGPPKLRITGIDVPETGlhPCKTIEETGKRLAEYAELFNVSFDYHG-ISSQWENIRIEDINIDKDEVLIINCLHK 85 
                                   79*******************9999999************************.7*************************** PP

                          GRAS 210 lhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErell 290
                                   + +l de+ +++s+rd+vL  vk+++P+v+++   +  ++s+ Fl rf e l y+s+lfd+l+++++r +e+ri +Er ll
  Zjn_sc00016.1.g06200.1.am.mk  86 MNNLGDETEDMDSARDRVLCNVKKMNPEVLIIGVVNGAYSSPFFLSRFREVLFYFSSLFDMLNTTVARSHEARILIERYLL 166
                                   ********************************************************************************* PP

                          GRAS 291 greivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvS 371
                                   g ++ nvvacegaer+er et+++Wr+r  +aGFk++p+++ + k       k + + + ++e+ ++l++gWk+r + ++S
  Zjn_sc00016.1.g06200.1.am.mk 167 GAAVLNVVACEGAERIERPETYKQWRRRSLKAGFKQLPVNQAILKRSTEETGKSYHEDFIIDEDGDWLLQGWKGRIMHALS 247
                                   *********************************************9999999999888*********************** PP

                          GRAS 372 aWr 374
                                   +W+
  Zjn_sc00016.1.g06200.1.am.mk 248 SWK 250
                                   **8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098538.8411230IPR005202Transcription factor GRAS
PfamPF035143.1E-666250IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MRTAEHLASR EGGPPKLRIT GIDVPETGLH PCKTIEETGK RLAEYAELFN VSFDYHGISS  60
QWENIRIEDI NIDKDEVLII NCLHKMNNLG DETEDMDSAR DRVLCNVKKM NPEVLIIGVV  120
NGAYSSPFFL SRFREVLFYF SSLFDMLNTT VARSHEARIL IERYLLGAAV LNVVACEGAE  180
RIERPETYKQ WRRRSLKAGF KQLPVNQAIL KRSTEETGKS YHEDFIIDED GDWLLQGWKG  240
RIMHALSSWK PK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-245250129375GRAS family transcription factor containing p
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002440450.11e-138hypothetical protein SORBIDRAFT_09g001140
SwissprotO809333e-94SCL9_ARATH; Scarecrow-like protein 9
TrEMBLC5YYG61e-138C5YYG6_SORBI; Putative uncharacterized protein Sb09g001140
STRINGSb09g001140.11e-137(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150538118
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.12e-95GRAS family protein